Proteintech, 28137-1-AP, C3orf31 Polyclonal antibody

Size: 20ul / 150ul The C3orf31 (28137-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf31 in WB, IHC, ELISA applications with reactivity to Human samples 28137-1-AP targets C3orf31 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26826 Product name: Recombinant human C3orf31 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-316 aa of BC015088 Sequence: MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYSSLKLHKMWKGWLRKTS Predict reactive species Full Name: chromosome 3 open reading frame 31 Calculated Molecular Weight: 316 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC015088 Gene Symbol: C3orf31 Gene ID (NCBI): 132001 RRID: AB_2881071 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BW9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.