Iright
BRAND / VENDOR: Proteintech

Proteintech, 28142-1-AP, CENPE Polyclonal antibody

CATALOG NUMBER: 28142-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CENPE (28142-1-AP) by Proteintech is a Polyclonal antibody targeting CENPE in WB, ELISA applications with reactivity to Human samples 28142-1-AP targets CENPE in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27230 Product name: Recombinant human CENPE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2401-2500 aa of NM_001286734 Sequence: MESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLR Predict reactive species Full Name: centromere protein E, 312kDa Calculated Molecular Weight: 316 kDa Observed Molecular Weight: 300-316 kDa GenBank Accession Number: NM_001286734 Gene Symbol: CENPE Gene ID (NCBI): 1062 RRID: AB_2881072 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02224 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924