Iright
BRAND / VENDOR: Proteintech

Proteintech, 28144-1-AP, DCHS1 Polyclonal antibody

CATALOG NUMBER: 28144-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCHS1 (28144-1-AP) by Proteintech is a Polyclonal antibody targeting DCHS1 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 28144-1-AP targets DCHS1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information DCHS1 is one of two known pathogenic genes associated with mitral valve prolapse (MVP) , a common cardiac valve disease (PMID: 33225636). Dchs1 and Fat4 function as a ligand-receptor pair during murine development and these genes are required in multiple organs (PMID: 21303848). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27226 Product name: Recombinant human DCHS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1517-1718 aa of NM_003737 Sequence: MPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEIN Predict reactive species Full Name: dachsous 1 (Drosophila) Calculated Molecular Weight: 346 kDa Observed Molecular Weight: ~350 kDa GenBank Accession Number: NM_003737 Gene Symbol: DCHS1 Gene ID (NCBI): 8642 RRID: AB_3669648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924