Iright
BRAND / VENDOR: Proteintech

Proteintech, 28174-1-AP, SCARF1 Polyclonal antibody

CATALOG NUMBER: 28174-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCARF1 (28174-1-AP) by Proteintech is a Polyclonal antibody targeting SCARF1 in WB, IF/ICC, ELISA applications with reactivity to human samples 28174-1-AP targets SCARF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, SMMC-7721 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Scavenger receptor class F member 1 (SCARF1), also known as scavenger receptor expressed by endothelial cells (SREC)-I, belongs to the scavenger receptor (SR) superfamily. SCARF1 has been shown to bind modified low density lipoproteins (LDLs), including acetylated (Ac-) and oxidized (ox-) LDLs (PMID: 29725698; PMID: 15145948). In addition to binding and internalizing a diverse range of endogenous proteins, SCARF1 also binds a wide array of viral, fungal, and bacterial antigens (PMID: 29242513). SCARF1 has a calculated molecular weight of 87 kDa, with a molecular weight of 140-160 kDa due to N-glycosylation (PMID: 22279061; PMID: 15145948). SCARF1 can also exist as a dimer (~ 180 kDa) and a truncated soluble form (~ 60 kDa) (PMID: 29242513; PMID: 29725698). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28079 Product name: Recombinant human SCARF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 695-830 aa of BC039735 Sequence: AGKPRGSEGPVRSVFRHFGSFQKGQAEAKVKRAIPKPPRQALNRKKGSPGLASGSVGQSPNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPISRPPEP Predict reactive species Full Name: scavenger receptor class F, member 1 Calculated Molecular Weight: 830 aa, 87 kDa Observed Molecular Weight: 90 kDa, 180 kDa GenBank Accession Number: BC039735 Gene Symbol: SCARF1 Gene ID (NCBI): 8578 RRID: AB_3086035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14162 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924