Iright
BRAND / VENDOR: Proteintech

Proteintech, 28178-1-AP, CDC123/C10orf7 Polyclonal antibody

CATALOG NUMBER: 28178-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDC123/C10orf7 (28178-1-AP) by Proteintech is a Polyclonal antibody targeting CDC123/C10orf7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 28178-1-AP targets CDC123/C10orf7 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, HeLa cells, Jurkat cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26828 Product name: Recombinant human CDC123 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 289-318 aa of BC001600 Sequence: CTNSEVTVQPSPYLSYRLPKDFVDLSTGED Predict reactive species Full Name: cell division cycle 123 homolog (S. cerevisiae) Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 35-39 kDa GenBank Accession Number: BC001600 Gene Symbol: CDC123 Gene ID (NCBI): 8872 RRID: AB_2881081 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75794 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924