Iright
BRAND / VENDOR: Proteintech

Proteintech, 28192-1-AP, WBSCR22 Polyclonal antibody

CATALOG NUMBER: 28192-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WBSCR22 (28192-1-AP) by Proteintech is a Polyclonal antibody targeting WBSCR22 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 28192-1-AP targets WBSCR22 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WBSCR22 (Williams-Beuren syndrome chromosomal region 22 protein), also known as BUD23, MERM1, is affected in Williams-Beuren syndrome and has been implicated in tumorigenesis and metastasis formation. WBSCR22 contains a nuclear localization signal and a common S-adenosyl-L-methionine binding motif that is evolutionarily conserved in methyltransferases (PMID: 29133897, 25525153). WBSCR22 protein is expressed at a high level in invasive breast cancer and its ectopic expression enhances tumor cell survival in the vasculature (PMID: 24086612). Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28094 Product name: Recombinant human WBSCR22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC000169 Sequence: MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRL Predict reactive species Full Name: Williams Beuren syndrome chromosome region 22 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000169 Gene Symbol: WBSCR22 Gene ID (NCBI): 114049 RRID: AB_2918150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43709 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924