Product Description
Size: 20ul / 150ul
The BDNF (28205-1-AP) by Proteintech is a Polyclonal antibody targeting BDNF in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
28205-1-AP targets BDNF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, PC-12 cells, SH-SY5Y cells, rat brain tissue, rat cerebellum, C6 cells
Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunohistochemistry (IHC): IHC : 1:400-1:1600
Background Information
1) What is BDNF?BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.2) FAQs for BDNFA) I can detect more than one band in my samplesBDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag28276 Product name: Recombinant human BDNF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 129-247 aa of BC029795 Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR Predict reactive species
Full Name: brain-derived neurotrophic factor
Calculated Molecular Weight: 247 aa, 28 kDa
Observed Molecular Weight: 28-30 kDa
GenBank Accession Number: BC029795
Gene Symbol: BDNF
Gene ID (NCBI): 627
RRID: AB_2818984
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P23560
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
FAQ
A) I can detect more than one band in my samplesBDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).
ProtocolsProduct Specific ProtocolsIHC protocol for BDNF antibody 28205-1-APDownload protocolWB protocol for BDNF antibody 28205-1-APDownload protocolStandard ProtocolsClick here to view our Standard Protocols
ProtocolsProduct Specific ProtocolsIHC protocol for BDNF antibody 28205-1-APDownload protocolWB protocol for BDNF antibody 28205-1-APDownload protocolStandard ProtocolsClick here to view our Standard Protocols
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924