Proteintech, 28209-1-AP, mAID tag Polyclonal antibody

Size: 20ul / 150ul The mAID tag (28209-1-AP) by Proteintech is a Polyclonal antibody targeting mAID tag in WB, ELISA applications with reactivity to human samples 28209-1-AP targets mAID tag in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein, transfected HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information This antibody detect the miniAID tag. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27843 Product name: Recombinant arabidopsis thaliana mAID tag protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of Sequence: KEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYK Predict reactive species Full Name: mAID tag Calculated Molecular Weight: 8 kDa RRID: AB_2881090 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.