Proteintech, 28212-1-AP, SREBF2 Polyclonal antibody

Size: 20ul / 150ul The SREBF2 (28212-1-AP) by Proteintech is a Polyclonal antibody targeting SREBF2 in WB, IP, ELISA applications with reactivity to human samples 28212-1-AP targets SREBF2 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, HepG2 cells, PC-3 cells, HeLa cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis. SREBF2 expression is dynamically regulated in response to nutritional and hormonal cues. SREBF2 exists two isoform with molecular weight 124 kDa and 73 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, hamster, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species Full Name: sterol regulatory element binding transcription factor 2 Calculated Molecular Weight: 124 kDa Observed Molecular Weight: 73-75 kDa, 120-130 kDa GenBank Accession Number: BC056158 Gene Symbol: SREBF2 Gene ID (NCBI): 6721 RRID: AB_2881091 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12772 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.