Iright
BRAND / VENDOR: Proteintech

Proteintech, 28261-1-AP, RNF139 Polyclonal antibody

CATALOG NUMBER: 28261-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNF139 (28261-1-AP) by Proteintech is a Polyclonal antibody targeting RNF139 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28261-1-AP targets RNF139 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HT-29 cells, HepG2 cells, THP-1 cells, U-87 MG cells, U2OS cells Positive IHC detected in: rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information The RNF139 gene (ring-finger protein 139), also known as TRC8 (translocation in renal carcinoma from chromosome 8), was first identified from a family with 3;8 chromosomal translocation and hereditary renal cell carcinoma and thyroid cancer (PMID:22689053). RNF139 encodes an endoplasmic reticulum (ER) protein with 10 transmembrane segments that contain a sterol-sensing domain and a RING finger motif encoding an E3 ubiquitin ligase (PMID: 19706601). Northern blot and dot blot show that RNF139 is highly expressed in the testis, placenta, and adrenal gland and is expressed at lower levels in the heart, brain, liver, skeletal muscle, and pancreas (PMID: 9689122). It is reported that TRC8 suppresses tumorigenesis by targeting heme oxygenase-1 (HO-1), an antioxidant enzyme highly expressed in various cancers, for ubiquitination and degradation (PMID:22689053). TRC8 is also involved in cholesterol and fatty acid biosynthesis that are transcriptionally regulated by the sterol response element binding proteins (SREBPs) (PMID:17016439). Acetylation, phosphorylation, and autoubiquitination are common post-translational modifications of FNF139 protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27147 Product name: Recombinant human RNF139 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 511-664 aa of BC064636 Sequence: QAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD Predict reactive species Full Name: ring finger protein 139 Calculated Molecular Weight: 664 aa, 76 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC064636 Gene Symbol: RNF139 Gene ID (NCBI): 11236 RRID: AB_3086042 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WU17 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924