Proteintech, 28274-1-AP, RAB17 Polyclonal antibody

Size: 20ul / 150ul The RAB17 (28274-1-AP) by Proteintech is a Polyclonal antibody targeting RAB17 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 28274-1-AP targets RAB17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RAB17 is a member of the RAS oncogene family and is classified as a small GTPase that plays a crucial role in intracellular membrane trafficking It is specifically expressed in epithelial cells and is involved in various cellular functions such as transcytosis, the directed movement of endocytosed material through the cell and its exocytosis from the plasma membrane at the opposite side. This process is mainly observed in epithelial cells and is important for the transcellular transport of substances like immunoglobulins from the basolateral surface to the apical surface. RAB17 is also implicated in the regulation of melanosome transport and release from melanocytes, which is critical for pigmentation in skin cells. Additionally, it has been suggested to regulate dendrite and dendritic spine development, which are important for neuronal function. The protein is involved in membrane trafficking through apical recycling endosomes in a post-endocytic step of transcytosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27206 Product name: Recombinant human RAB17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-212 aa of BC050426 Sequence: TRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCCAH Predict reactive species Full Name: RAB17, member RAS oncogene family Calculated Molecular Weight: 212 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC050426 Gene Symbol: RAB17 Gene ID (NCBI): 64284 RRID: AB_2881103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0T7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.