Iright
BRAND / VENDOR: Proteintech

Proteintech, 28302-1-AP, H2-K1 Polyclonal antibody

CATALOG NUMBER: 28302-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The H2-K1 (28302-1-AP) by Proteintech is a Polyclonal antibody targeting H2-K1 in WB, ELISA applications with reactivity to human, mouse, rat samples 28302-1-AP targets H2-K1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat lung tissue, RAW 264.7 cells, mouse brain tissue, Jurkat cells, mouse liver tissue, mouse lung tissue, mouse spleen tissue, mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information H2-K1 (histocompatibility 2, K1, K region) is a gene that encodes a class I major histocompatibility complex (MHC) protein in the mouse (Mus musculus). This protein plays a crucial role in the immune system by presenting peptide antigens to T cells, which is essential for the activation of cytotoxic T lymphocytes (CTLs) and the subsequent immune response. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28456 Product name: Recombinant mouse H2-K1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-262 aa of NM_001001892 Sequence: YVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTF Predict reactive species Full Name: histocompatibility 2, K1, K region Calculated Molecular Weight: 41 aa Observed Molecular Weight: 42-50 kDa GenBank Accession Number: NM_001001892 Gene Symbol: H2-K1 Gene ID (NCBI): 14972 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01901 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924