Iright
BRAND / VENDOR: Proteintech

Proteintech, 28315-1-AP, SCN4A Polyclonal antibody

CATALOG NUMBER: 28315-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCN4A (28315-1-AP) by Proteintech is a Polyclonal antibody targeting SCN4A in IHC, ELISA applications with reactivity to human, mouse samples 28315-1-AP targets SCN4A in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Sodium channel protein type 4 subunit alpha (SCN4A, also known as Nav1.4) is the pore-forming subunit of the primary sodium channel present in skeletal muscles (PMID: 16193245). Nav1.4 related channelopathies that affect skeletal muscle excitability are dominant diseases classified in two opposite groups as defined by the prevalent clinical symptoms: muscle stiffness and hypertonia (myotonia) episodes [non dystrophic myotonias (NDM)], and muscle weakness resulting in paralysis episodes (periodic paralyses; PP) (PMID: 20237798; 26285000). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27536 Product name: Recombinant human SCN4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 803-1026 aa of NM_000334 Sequence: MSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLYDGNSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFK Predict reactive species Full Name: sodium channel, voltage-gated, type IV, alpha subunit Calculated Molecular Weight: 208 kDa GenBank Accession Number: NM_000334 Gene Symbol: SCN4A Gene ID (NCBI): 6329 RRID: AB_2881109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35499 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924