Proteintech, 28316-1-AP, EOMES/TBR2 Polyclonal antibody

Size: 20ul / 150ul The EOMES/TBR2 (28316-1-AP) by Proteintech is a Polyclonal antibody targeting EOMES/TBR2 in WB, ELISA applications with reactivity to Human, Mouse, rat samples 28316-1-AP targets EOMES/TBR2 in WB, ELISA applications and shows reactivity with Human, Mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information EOMES/TRB2 (also named Eomesodermin/Tbr2) encode T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller sub ventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880). Specification Tested Reactivity: Human, Mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27634 Product name: Recombinant human EOMES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 575-676 aa of NM_001278182 Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM Predict reactive species Full Name: eomesodermin homolog (Xenopus laevis) Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 70-72 kDa GenBank Accession Number: NM_001278182 Gene Symbol: EOMES Gene ID (NCBI): 8320 RRID: AB_2881110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.