Proteintech, 28321-1-AP, LYVE1 Polyclonal antibody

Size: 20ul / 150ul The LYVE1 (28321-1-AP) by Proteintech is a Polyclonal antibody targeting LYVE1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 28321-1-AP targets LYVE1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, bEnd.3 cells, mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue Positive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information LYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and have a role in tumor metastasis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28131 Product name: Recombinant human LYVE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 192-322 aa of BC026231 Sequence: SIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV Predict reactive species Full Name: lymphatic vessel endothelial hyaluronan receptor 1 Calculated Molecular Weight: 322 aa, 35 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC026231 Gene Symbol: LYVE1 Gene ID (NCBI): 10894 RRID: AB_3086043 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5Y7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.