Iright
BRAND / VENDOR: Proteintech

Proteintech, 28345-1-AP, GDF1 Polyclonal antibody

CATALOG NUMBER: 28345-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GDF1 (28345-1-AP) by Proteintech is a Polyclonal antibody targeting GDF1 in WB, ELISA applications with reactivity to Human, mouse, rat samples 28345-1-AP targets GDF1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GDF1 is a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. Studies in rodents suggest that this protein is involved in the establishment of left-right asymmetry in early embryogenesis and in neural development in later embryogenesis. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28831 Product name: Recombinant human GDF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-273 aa of NM_001492 Sequence: LFRRRDPQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASAAGHCPEWTVVFDLSAVEPAERPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGPVLLRQLVPALGPPVRAELLGAAWARNASWPRSLRLALALRPRAPAACARLAEASLLLVTLDPRLCHPLARPRRDAEPVLGGGPGGACRARRLY Predict reactive species Full Name: growth differentiation factor 1 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: NM_001492 Gene Symbol: GDF1 Gene ID (NCBI): 2657 RRID: AB_3086045 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P27539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924