Proteintech, 28347-1-AP, EEA1 Polyclonal antibody

Size: 20ul / 150ul The EEA1 (28347-1-AP) by Proteintech is a Polyclonal antibody targeting EEA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 28347-1-AP targets EEA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, C6 cells Positive IHC detected in: human breast cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28814 Product name: Recombinant human EEA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1151-1350 aa of NM_003566 Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA Predict reactive species Full Name: early endosome antigen 1 Calculated Molecular Weight: 162 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: NM_003566 Gene Symbol: EEA1 Gene ID (NCBI): 8411 RRID: AB_2881117 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15075 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.