Proteintech, 28348-1-AP, Integrin alpha-9 Polyclonal antibody

Size: 20ul / 150ul The Integrin alpha-9 (28348-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-9 in WB, ELISA applications with reactivity to Human, Mouse samples 28348-1-AP targets Integrin alpha-9 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). Integrin alpha 9 contains a large N-terminal extracellular domain with 7 conserved repeats of putative metal-binding domains, a transmembrane segment, and a short C-terminal cytoplasmic tail (PMID: 8245132). Integrin alpha 9 interacts with integrin beta 1 generating α9β1 heterodimer, which is expressed in many cell types including epithelial cells, neutrophils, hepatocytes, muscle and endothelial cells (PMID: 21975548). It binds to a diversity of ligands in the extracellular matrix, like the a-disintegrin and metalloprotease (ADAM) family, THBS1, EMILIN1, VEGF, tenascin-C, osteopontin, fibronectin, and VCAM1 (PMID: 21975548; 33790909). Integrin α9β1 has been implicated in diverse biological functions including angiogenesis, lymphangiogenesis, lymphatic valve morphogenesis, granulopoiesis and tumorigenesis (PMID: 20179422). Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28815 Product name: Recombinant human Integrin alpha-9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 462-613 aa of BC030198 Sequence: VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQ Predict reactive species Full Name: integrin, alpha 9 Calculated Molecular Weight: 114 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC030198 Gene Symbol: Integrin alpha 9 Gene ID (NCBI): 3680 RRID: AB_3669655 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.