Iright
BRAND / VENDOR: Proteintech

Proteintech, 28358-1-AP, Caveolin-3 Polyclonal antibody

CATALOG NUMBER: 28358-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Caveolin-3 (28358-1-AP) by Proteintech is a Polyclonal antibody targeting Caveolin-3 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 28358-1-AP targets Caveolin-3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse heart tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse heart tissue, rat skeletal muscle tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue Positive IF/ICC detected in: H9C2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28009 Product name: Recombinant human Caveolin-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-40 aa of BC069368 Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVD Predict reactive species Full Name: caveolin 3 Calculated Molecular Weight: 151 aa, 17 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC069368 Gene Symbol: Caveolin-3 Gene ID (NCBI): 859 RRID: AB_2881120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924