Iright
BRAND / VENDOR: Proteintech

Proteintech, 28359-1-AP, UNC93B1 Polyclonal antibody

CATALOG NUMBER: 28359-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UNC93B1 (28359-1-AP) by Proteintech is a Polyclonal antibody targeting UNC93B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 28359-1-AP targets UNC93B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat kidney tissue, rat spleen tissue, pig spleen tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Unc-93 homolog B1 (UNC93B1) is a key regulator of nucleic acid (NA)-sensing Toll-like receptors (TLRs). UNC93B1 plays an important role in innate and adaptive immunity by regulating nucleotide-sensing Toll-like receptor (TLR) signaling. It's a transmembrane protein that is known to control the movement of TLRs from the endoplasmic reticulum-where TLRs are assembled-to endosomes. The calculated MW of UNC93B1 is 66 kDa, 28359-1-AP can detect a band around 70 kDa. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27937 Product name: Recombinant human UNC93B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC101568 Sequence: MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDS Predict reactive species Full Name: unc-93 homolog B1 (C. elegans) Calculated Molecular Weight: 597 aa, 67 kDa Observed Molecular Weight: ~70 kDa GenBank Accession Number: BC101568 Gene Symbol: UNC93B1 Gene ID (NCBI): 81622 RRID: AB_3086046 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1C4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924