Proteintech, 28368-1-AP, ARPC1B Polyclonal antibody

Size: 20ul / 150ul The ARPC1B (28368-1-AP) by Proteintech is a Polyclonal antibody targeting ARPC1B in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 28368-1-AP targets ARPC1B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissue, human lung cancer tissue, mouse brain tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29001 Product name: Recombinant human ARPC1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-372 aa of BC007555 Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK Predict reactive species Full Name: actin related protein 2/3 complex, subunit 1B, 41kDa Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC007555 Gene Symbol: ARPC1B Gene ID (NCBI): 10095 RRID: AB_2881125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15143 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.