Iright
BRAND / VENDOR: Proteintech

Proteintech, 28369-1-AP, COMP Polyclonal antibody

CATALOG NUMBER: 28369-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COMP (28369-1-AP) by Proteintech is a Polyclonal antibody targeting COMP in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 28369-1-AP targets COMP in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse cartilage tissue, rat cartilage tissue, pig cartilage tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information COMP is a secreted pentameric glycoprotein built from modular units and belongs to the thrombospondin protein family. COMP is expressed by hypertrophic chondrocytes and osteoblasts during endochondral ossification, and its expression is increased during fracture healing. COMP is involved in the assembly of collagen fibrils and other structural matrix components. COMP interacts with a number of cartilage ECM proteins, including fibronectin, collagen I, II IX, XII, and XIV, matrilins, as well as proteoglycans such as aggrecan and others. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28749 Product name: Recombinant human COMP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-257 aa of BC033676 Sequence: LRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAV Predict reactive species Full Name: cartilage oligomeric matrix protein Calculated Molecular Weight: 757 aa, 83 kDa Observed Molecular Weight: 80-110 kDa GenBank Accession Number: BC033676 Gene Symbol: COMP Gene ID (NCBI): 1311 RRID: AB_2881126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49747 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924