Iright
BRAND / VENDOR: Proteintech

Proteintech, 28393-1-AP, Beta TRCP Polyclonal antibody

CATALOG NUMBER: 28393-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Beta TRCP (28393-1-AP) by Proteintech is a Polyclonal antibody targeting Beta TRCP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28393-1-AP targets Beta TRCP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, NIH/3T3 cells, U-251 cells, Ramos cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BTRC, also named as BTRCP, FBW1A, and FBXW1A, is an F-box family protein. It is a Substrate recognition component of an SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. BTRC targets many important proteins with diverse functions, such as p53, HRAS, NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5, and the cell cycle checkpoint protein claspin, for ubiquitin-mediated degradation. It is required for the activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB, and TNF. Required for proteolytic processing of GLI3. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28739 Product name: Recombinant human BETA-TRCP,BTRC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-605 aa of BC027994 Sequence: CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR Predict reactive species Full Name: beta-transducin repeat containing Calculated Molecular Weight: 605 aa, 69 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC027994 Gene Symbol: Beta TRCP Gene ID (NCBI): 8945 RRID: AB_2935467 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924