Iright
BRAND / VENDOR: Proteintech

Proteintech, 28400-1-AP, MSTO1 Polyclonal antibody

CATALOG NUMBER: 28400-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MSTO1 (28400-1-AP) by Proteintech is a Polyclonal antibody targeting MSTO1 in WB, IHC, ELISA applications with reactivity to human samples 28400-1-AP targets MSTO1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information MSTO1, also named as LST005 and SLTP005, belongs to the misato family. Human MSTO1 is a ubiquitously expressed, evolutionary conserved protein with homologous regions to GTPases. MSTO1 is a cytoplasmic protein that modulates mitochondrial dynamics by promoting mitochondrial fusion. MSTO1 has 7 isoforms produced by alternative splicing. (PMID: 33612823) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29067 Product name: Recombinant human MSTO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 28-256 aa of BC002535 Sequence: QDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGR Predict reactive species Full Name: misato homolog 1 (Drosophila) Observed Molecular Weight: 57-62 kDa GenBank Accession Number: BC002535 Gene Symbol: MSTO1 Gene ID (NCBI): 55154 RRID: AB_2881133 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924