Iright
BRAND / VENDOR: Proteintech

Proteintech, 28417-1-AP, TH1L Polyclonal antibody

CATALOG NUMBER: 28417-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TH1L (28417-1-AP) by Proteintech is a Polyclonal antibody targeting TH1L in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 28417-1-AP targets TH1L in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells Positive IP detected in: Jurkat cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29262 Product name: Recombinant human TH1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-150 aa of BC014952 Sequence: IMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLSENYTAVAQTVNLLAEWLIQTGVEPVQVQETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMI Predict reactive species Full Name: TH1-like (Drosophila) Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC014952 Gene Symbol: TH1L Gene ID (NCBI): 51497 RRID: AB_2881137 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXH7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924