Iright
BRAND / VENDOR: Proteintech

Proteintech, 28424-1-AP, FBXW7 Polyclonal antibody

CATALOG NUMBER: 28424-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FBXW7 (28424-1-AP) by Proteintech is a Polyclonal antibody targeting FBXW7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 28424-1-AP targets FBXW7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, MCF-7 cells, mouse brain tissue Positive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FBXW7, also named as FBW7, FBX30, SEL10 and hAgo, is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins. FBXW7 is involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. FBXW7 is a general tumor suppressor in human cancer (PMID: 17909001). FBXW7 has 3 isoforms (α/β/γ) with the calculated molecular mass of 80 kDa, 70 kDa and 66 kDa, and apparent molecular mass of 100-110 kDa and 66-75 kDa (PMID: 31346036/PMID: 22864569). K48 autoubiquitination is consistent with maintenance of ubiquitinated FBW7 (Ub-FBW7, 200 kDa)(PMID: 32353058). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28471 Product name: Recombinant human FBXW7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-227 aa of NM_001349798 Sequence: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS Predict reactive species Full Name: F-box and WD repeat domain containing 7 Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 100-110 kDa, 66-75 kDa GenBank Accession Number: NM_001349798 Gene Symbol: FBXW7 Gene ID (NCBI): 55294 RRID: AB_2881138 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969H0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924