Iright
BRAND / VENDOR: Proteintech

Proteintech, 28432-1-AP, OLFM4 Polyclonal antibody

CATALOG NUMBER: 28432-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OLFM4 (28432-1-AP) by Proteintech is a Polyclonal antibody targeting OLFM4 in IHC, ELISA applications with reactivity to Human samples 28432-1-AP targets OLFM4 in IHC, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Olfactomedin-4 (OLFM4), also named as hGC-1 (human G-CSF-stimulated clone-1) or antiapoptotic protein GW112, is a secreted glycoprotein normally expressed in bone marrow, prostate, small intestine, stomach, colon and pancreas (PMID: 11867215; PMID: 22471589). OLFM4 has been found to be up-regulated in gastrointestinal cancer and inflammatory disease including inflammatory bowel disease and H. pylori infection (PMID: 20534456). OLFM4 is involved in cellular process such as apoptosis, cell adhesion and tumor growth (PMID: 22471589; 16566923; 15059901). Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28914 Product name: Recombinant human OLFM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-233 aa of NM_006418 Sequence: LGSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQN Predict reactive species Full Name: olfactomedin 4 Calculated Molecular Weight: 57 kDa GenBank Accession Number: NM_006418 Gene Symbol: OLFM4 Gene ID (NCBI): 10562 RRID: AB_2918163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UX06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924