Iright
BRAND / VENDOR: Proteintech

Proteintech, 28433-1-AP, CCDC171 Polyclonal antibody

CATALOG NUMBER: 28433-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC171 (28433-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC171 in WB, ELISA applications with reactivity to mouse, rat, human samples 28433-1-AP targets CCDC171 in WB, ELISA applications and shows reactivity with mouse, rat, human samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: mouse, rat, human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28926 Product name: Recombinant human CCDC171 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of NM_173550 Sequence: MNLNTSSNTGDTQRLKIASLDVKQILKNETELDITDNLRKKLHWAKKEKLEITTKHNAELASYESQIAKLRSEVEKGEALRQSLEYDLAVARKEAGLGRRAAEERLAEAHRIQEKLCAQNSELQAKTNETEKAFQTSQQKWKEECRRFEHDLEERDNMIQNCNREYDLLMKEKSRLEKTLQEALEKHQREKNEMESHIRETALEEFRLQEEQWEAERREL Predict reactive species Full Name: chromosome 9 open reading frame 93 Calculated Molecular Weight: 153 kDa Observed Molecular Weight: 142 kDa GenBank Accession Number: NM_173550 Gene Symbol: CCDC171 Gene ID (NCBI): 203238 RRID: AB_2918164 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6TFL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924