Iright
BRAND / VENDOR: Proteintech

Proteintech, 28456-1-AP, HPF1 Polyclonal antibody

CATALOG NUMBER: 28456-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HPF1 (28456-1-AP) by Proteintech is a Polyclonal antibody targeting HPF1 in WB, IF/ICC, ELISA applications with reactivity to human samples 28456-1-AP targets HPF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HPF1 is also known as C4orf27 and belongs to the HPF1 family. HPF1 is a novel interacting component of PARP1 complex that plays an important role in PARP1-dependent ADP-ribosylation signaling in the DNA damage response and the maintenance of genome stability (PMID: 29549427). The calculated molecular weight of HPF1 is 39 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29377 Product name: Recombinant human C4orf27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC010367 Sequence: MVGGGGKRRPGGEGPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEELDPEKPSDSLSASLGLQLVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYH Predict reactive species Full Name: chromosome 4 open reading frame 27 Calculated Molecular Weight: 346 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC010367 Gene Symbol: HPF1 Gene ID (NCBI): 54969 RRID: AB_3086053 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924