Iright
BRAND / VENDOR: Proteintech

Proteintech, 28465-1-AP, DCPS Polyclonal antibody

CATALOG NUMBER: 28465-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCPS (28465-1-AP) by Proteintech is a Polyclonal antibody targeting DCPS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 28465-1-AP targets DCPS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, mouse testis tissue Positive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DcpS, which is a member of the histidine triad (HIT) superfamily of pyrophosphatases, is the first HIT protein with a defined biological function and identifies the HIT motif as a new mRNA decapping domain. DcpS can encode a 38-40 kDa protein, and has the potential to form a homodimer of 80 kDa(PMID: 12198172). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29351 Product name: Recombinant human DCPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-160 aa of BC014532 Sequence: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRN Predict reactive species Full Name: decapping enzyme, scavenger Calculated Molecular Weight: 337 aa, 39 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC014532 Gene Symbol: DCPS Gene ID (NCBI): 28960 RRID: AB_3086054 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96C86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924