Iright
BRAND / VENDOR: Proteintech

Proteintech, 28492-1-AP, Filamin-C Polyclonal antibody

CATALOG NUMBER: 28492-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Filamin-C (28492-1-AP) by Proteintech is a Polyclonal antibody targeting Filamin-C in WB, IHC, ELISA applications with reactivity to human samples 28492-1-AP targets Filamin-C in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SGC-7901 cells Positive IHC detected in: human colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Filamin C (FLNC; also known as γ-FLN; ABP-L; FLN2), a muscle-specific filamin and a large actin-cross-linking protein. Human filamins are ~280 kDa homodimers, each monomer consisting of an N-terminal actin-binding domain followed by 24 immunoglobulin (Ig)-like domains (d1 to d24), the last of which mediates dimerization. FLNC is specifically expressed in cardiomyocytes and skeletal myocytes and is involved in the maintenance of structural integrity. High filamin C associated with better prognosis of prostate cancer, leukemia and breast cancer patients. ( PMID: 25577646, PMID: 30867563, PMID: 31131323) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29328 Product name: Recombinant human filamin-c protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2161-2248 aa of NM_001458 Sequence: DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGL Predict reactive species Full Name: filamin C, gamma (actin binding protein 280) Calculated Molecular Weight: 291 kDa Observed Molecular Weight: 280-300 kDa GenBank Accession Number: NM_001458 Gene Symbol: FLNC Gene ID (NCBI): 2318 RRID: AB_2918171 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14315 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924