Proteintech, 28499-1-AP, FIG4 Polyclonal antibody

Size: 20ul / 150ul The FIG4 (28499-1-AP) by Proteintech is a Polyclonal antibody targeting FIG4 in WB, ELISA applications with reactivity to human, mouse, rat samples 28499-1-AP targets FIG4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, NIH/3T3 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FIG4 (also named SAC3) is a 5'-phosphoinositide phosphatase that coordinates the turnover of phosphatidylinositol-3,5-bisphosphate (PI(3,5)P2), a very low abundance phosphoinositide. Deficiency of FIG4 severely affects the human and mouse nervous systems by causing two distinct forms of abnormal lysosomal storage (PMID: 23165282). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28971 Product name: Recombinant human FIG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 654-792 aa of BC041338 Sequence: VNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVKMTDAGDSAKVTE Predict reactive species Full Name: FIG4 homolog (S. cerevisiae) Calculated Molecular Weight: 907 aa, 104 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC041338 Gene Symbol: FIG4 Gene ID (NCBI): 9896 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92562 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.