Proteintech, 28504-1-AP, SCN8A Polyclonal antibody

Size: 20ul / 150ul The SCN8A (28504-1-AP) by Proteintech is a Polyclonal antibody targeting SCN8A in IHC, ELISA applications with reactivity to Human, mouse samples 28504-1-AP targets SCN8A in IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26950 Product name: Recombinant human SCN8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1767-1907 aa of NM_001177984 Sequence: MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR Predict reactive species Full Name: sodium channel, voltage gated, type VIII, alpha subunit Calculated Molecular Weight: 225 kDa GenBank Accession Number: NM_001177984 Gene Symbol: SCN8A Gene ID (NCBI): 6334 RRID: AB_3086060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.