Proteintech, 28514-1-AP, APOOL Polyclonal antibody

Size: 20ul / 150ul The APOOL (28514-1-AP) by Proteintech is a Polyclonal antibody targeting APOOL in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 28514-1-AP targets APOOL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, HepG2 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human kidney tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information APOOL, the component of the MICOS complex, is a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Specifically binds to cardiolipin (in vitro) but not to the precursor lipid phosphatidylglycerol. Plays a crucial role in crista junction formation and mitochondrial function (PubMed:23704930), (PubMed:25764979). Its molecular weight is about 30 kDa. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29392 Product name: Recombinant human APOOL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 127-268 aa of BC107096 Sequence: VSARKGSKFKKITYPLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS Predict reactive species Full Name: apolipoprotein O-like Calculated Molecular Weight: 268 aa, 29 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC107096 Gene Symbol: APOOL Gene ID (NCBI): 139322 RRID: AB_3086061 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.