Iright
BRAND / VENDOR: Proteintech

Proteintech, 28532-1-AP, PGC Polyclonal antibody

CATALOG NUMBER: 28532-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PGC (28532-1-AP) by Proteintech is a Polyclonal antibody targeting PGC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28532-1-AP targets PGC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse stomach tissue, rat stomach tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Pepsinogen II also known as progastricsin or PGC(pepsinogen C), is an aspartic protease expressed primarily in gastric chief cells and is a novel marker of type 2 cells with advantages over many of the current markers used to identify type 2 cells in the developing lung(PMID:14578117). It is involved in proteolysis and peptidolysis. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29347 Product name: Recombinant human PGC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC073740 Sequence: MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLF Predict reactive species Full Name: progastricsin (pepsinogen C) Calculated Molecular Weight: 388 aa, 42 kDa Observed Molecular Weight: 34-42 kDa GenBank Accession Number: BC073740 Gene Symbol: PGC Gene ID (NCBI): 5225 RRID: AB_2918173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20142 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924