Proteintech, 28549-1-AP, Alpha 2-Antiplasmin Polyclonal antibody

Size: 20ul / 150ul The Alpha 2-Antiplasmin (28549-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha 2-Antiplasmin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 28549-1-AP targets Alpha 2-Antiplasmin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, THP-1 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SERPINF2, also termed Alpha-2-antiplasmin(a2-AP), a member of the serpin family of serine protease inhibitors. SERPINF2 is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in SERPINF2 result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29670 Product name: Recombinant human SERPINF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 348-491 aa of BC031592 Sequence: VATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIFEDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSPK Predict reactive species Full Name: serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 Calculated Molecular Weight: 491 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC031592 Gene Symbol: Alpha-2-antiplasmin Gene ID (NCBI): 5345 RRID: AB_2918174 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08697 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.