Iright
BRAND / VENDOR: Proteintech

Proteintech, 28550-1-AP, GRIK5 Polyclonal antibody

CATALOG NUMBER: 28550-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GRIK5 (28550-1-AP) by Proteintech is a Polyclonal antibody targeting GRIK5 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 28550-1-AP targets GRIK5 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29363 Product name: Recombinant human GRIK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 845-980 aa of NM_001301030 Sequence: MLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRELAEHE Predict reactive species Full Name: glutamate receptor, ionotropic, kainate 5 Calculated Molecular Weight: 109 kDa Observed Molecular Weight: ~110 kDa GenBank Accession Number: NM_001301030 Gene Symbol: GRIK5 Gene ID (NCBI): 2901 RRID: AB_3086064 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16478 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924