Iright
BRAND / VENDOR: Proteintech

Proteintech, 28566-1-AP, MATN1 Polyclonal antibody

CATALOG NUMBER: 28566-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MATN1 (28566-1-AP) by Proteintech is a Polyclonal antibody targeting MATN1 in WB, IF/ICC, ELISA applications with reactivity to pig, human samples 28566-1-AP targets MATN1 in WB, IF/ICC, ELISA applications and shows reactivity with pig, human samples. Tested Applications Positive WB detected in: pig cartilage tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MATN1 (matrilin 1), also known as CMP. It is expected to be located in extracellular space, the protein is mainly expressed in cartilage tissue and retina tissue. Also, the protein is a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene have been associated with variety of inherited chondrodysplasias. It is reproted that COMP and matrilin-1 elute together in the gel filtration of cartilage extracts and can be co-immunoprecipitated with the presence of calcium (PMID: 15075323). The calculated molecular weight of MATN1 is 54 kDa. Specification Tested Reactivity: pig, human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29386 Product name: Recombinant human MATN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-280 aa of NM_002379 Sequence: SVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLI Predict reactive species Full Name: matrilin 1, cartilage matrix protein Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: NM_002379 Gene Symbol: MATN1 Gene ID (NCBI): 4146 RRID: AB_3669662 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924