Product Description
Size: 20ul / 150ul
The Ins1 (28588-1-AP) by Proteintech is a Polyclonal antibody targeting Ins1 in WB, IHC, ELISA applications with reactivity to mouse, rat samples
28588-1-AP targets Ins1 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.
Tested Applications
Positive WB detected in: rat pancreas tissue
Positive IHC detected in: mouse pancreas tissue, rat pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:2500-1:10000
Background Information
Insulin 1 is a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus.
Specification
Tested Reactivity: mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag29988 Product name: Recombinant mouse insulin1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-87 aa of NM_008386 Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR Predict reactive species
Full Name: insulin I
Calculated Molecular Weight: 12 kDa
Observed Molecular Weight: 12 kDa
GenBank Accession Number: NM_008386
Gene Symbol: Ins1
Gene ID (NCBI): 16333
RRID: AB_2881177
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P01325
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924