Iright
BRAND / VENDOR: Proteintech

Proteintech, 28591-1-AP, APOL3 Polyclonal antibody

CATALOG NUMBER: 28591-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The APOL3 (28591-1-AP) by Proteintech is a Polyclonal antibody targeting APOL3 in WB, ELISA applications with reactivity to Human samples 28591-1-AP targets APOL3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, BxPC-3 cells, HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Apolipoprotein L3(APOL3) is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. APOL3 is localized in the cytoplasm and plays a central role in cholesterol transport, affecting the movement of lipids, including cholesterol, and allowing the binding of lipids to organelles. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29687 Product name: Recombinant human APOL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-380 aa of NM_145640 Sequence: SSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQ Predict reactive species Full Name: apolipoprotein L, 3 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: NM_145640 Gene Symbol: APOL3 Gene ID (NCBI): 80833 RRID: AB_3669663 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95236 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924