Iright
BRAND / VENDOR: Proteintech

Proteintech, 28617-1-AP, PPP1CA Polyclonal antibody

CATALOG NUMBER: 28617-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1CA (28617-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1CA in WB, IHC, ELISA applications with reactivity to Human samples 28617-1-AP targets PPP1CA in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28451 Product name: Recombinant human PPP1CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 140-330 aa of BC001888 Sequence: CKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK Predict reactive species Full Name: protein phosphatase 1, catalytic subunit, alpha isoform Calculated Molecular Weight: 330 aa, 38 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC001888 Gene Symbol: PPP1CA Gene ID (NCBI): 5499 RRID: AB_2918182 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62136 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924