Iright
BRAND / VENDOR: Proteintech

Proteintech, 28621-1-AP, KLHL32 Polyclonal antibody

CATALOG NUMBER: 28621-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLHL32 (28621-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL32 in WB, IF/ICC, ELISA applications with reactivity to human samples 28621-1-AP targets KLHL32 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells, PC-3 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KLHL32 (Kelch-like protein 32), also known BKLHD5, which is located in the cytoplasm. The expression level is high in the central nervous system, especially in astrocytes. In addition, it is also expressed in the motor cilia of fallopian tube. But the overall expression abundance is low. KLHL32 is mainly involved in the intracellular ubiquitination process. Ubiquitin is an important cellular regulatory mechanism, through which protein can be labeled to degrade or change its function. KLHL32 interacts with other protein through its BTB domain and Kelch repeat domain to help regulate this process. It is also a prognostic marker in glioblastoma and renal clear cell carcinoma. The molecular weight of KLHL32 is 70 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29003 Product name: Recombinant human KLHL32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 169-318 aa of BC071627 Sequence: KHLSELLKSRPEEVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENA Predict reactive species Full Name: kelch-like 32 (Drosophila) Calculated Molecular Weight: 470 aa, 53 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC071627 Gene Symbol: KLHL32 Gene ID (NCBI): 114792 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NJ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924