Product Description
Size: 20ul / 150ul
The BCAT1 (28622-1-AP) by Proteintech is a Polyclonal antibody targeting BCAT1 in WB, IHC, ELISA applications with reactivity to Human, rat samples
28622-1-AP targets BCAT1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.
Tested Applications
Positive WB detected in: C6 cells, Jurkat cells
Positive IHC detected in: human liver cancer tissue, human lung cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
BCAT1, also named as branched-chain amino acid trasaminase1, is a cytosolic enzyme responsible for the reversible transamination of leucine, isoleucine and valine that catalyzes the transformation of branched-chain L-amino acids (BCAA) into branched-chain a-ketoacids (BCKA), thereby providing macromolecule precursors. It has been reported that BCAT1 is associated with tumor growth and disease progression (PMID:29255149).
Specification
Tested Reactivity: Human, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag28998 Product name: Recombinant human BCAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-115 aa of BC033864 Sequence: MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLN Predict reactive species
Full Name: branched chain aminotransferase 1, cytosolic
Calculated Molecular Weight: 320 aa, 36 kDa
Observed Molecular Weight: 43-48 kDa
GenBank Accession Number: BC033864
Gene Symbol: BCAT1
Gene ID (NCBI): 586
RRID: AB_2881183
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P54687
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924