Iright
BRAND / VENDOR: Proteintech

Proteintech, 28644-1-AP, CCSAP Polyclonal antibody

CATALOG NUMBER: 28644-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCSAP (28644-1-AP) by Proteintech is a Polyclonal antibody targeting CCSAP in WB, IHC, ELISA applications with reactivity to mouse, rat samples 28644-1-AP targets CCSAP in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCSAP (Centriole, cilia and spindle-associated protein) colocalizes with polyglutamylated tubulin to centrioles, spindle microtubules, and cilia in human tissue culture cells (PMID: 22493317). Plays a role in microtubule (MT) stabilization and this stabilization involves the maintenance of NUMA1 at the spindle poles. It can be detected as around 30-36 kDa. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23785 Product name: Recombinant human C1orf96 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-270 aa of BC015419 Sequence: MSPGSGVKSEYMKRYQEPRWEEYGPCYRELLHYRLGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA Predict reactive species Full Name: chromosome 1 open reading frame 96 Observed Molecular Weight: 30-36 kDa GenBank Accession Number: BC015419 Gene Symbol: CCSAP/C1orf96 Gene ID (NCBI): 126731 RRID: AB_3086074 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IQ19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924