Iright
BRAND / VENDOR: Proteintech

Proteintech, 28651-1-AP, PLAG1 Polyclonal antibody

CATALOG NUMBER: 28651-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLAG1 (28651-1-AP) by Proteintech is a Polyclonal antibody targeting PLAG1 in WB, ELISA applications with reactivity to human samples 28651-1-AP targets PLAG1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29010 Product name: Recombinant human PLAG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC075047 Sequence: MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVS Predict reactive species Full Name: pleiomorphic adenoma gene 1 Calculated Molecular Weight: 500 aa, 56 kDa Observed Molecular Weight: 56-60 kDa GenBank Accession Number: BC075047 Gene Symbol: PLAG1 Gene ID (NCBI): 5324 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6DJT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924