Proteintech, 28667-1-AP, Synaptotagmin-3 Polyclonal antibody

Size: 20ul / 150ul The Synaptotagmin-3 (28667-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-3 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat samples 28667-1-AP targets Synaptotagmin-3 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-3 (SYT3) is highly expressed in brain, adipose tissue, and heart (PMID: 30545844). Synaptotagmin-3 is highly enriched in synaptic plasma membranes (PMID: 10373432). It has been reported that synaptotagmin-3 internalizes AMPA receptors to depress synaptic strength and promote forgetting (PMID: 30545844). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30027 Product name: Recombinant human SYT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 85-330 aa of BC028379 Sequence: DKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQAMDLPAKD Predict reactive species Full Name: synaptotagmin III Calculated Molecular Weight: 590 aa, 63 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC028379 Gene Symbol: Synaptotagmin-3 Gene ID (NCBI): 84258 RRID: AB_2918187 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.