Product Description
Size: 20ul / 150ul
The SGLT2 (28683-1-AP) by Proteintech is a Polyclonal antibody targeting SGLT2 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat samples
28683-1-AP targets SGLT2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse kidney tissue, rat kidney tissue
Positive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse kidney tissue, rat kidney tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
Sodium-glucose cotransporter 2 (SGLT2), encoded by SLC5A2, utilizes the electrochemical sodium gradient to transport glucose against the cell's internal concentration gradient. Mainly expressed on brush border membrane (BBM) of epithelial cells in the early segment of the proximal tubule, SGLT2 mediates most of the glucose reabsorption by the kidney overall. Inhibition of SGLT2 could improve glucose homeostasis of diabetic patients, which has been considered as a novel strategy for diabetes treatment.
Specification
Tested Reactivity: Human, mouse, rat
Cited Reactivity: mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30120 Product name: Recombinant human SLC5A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-285 aa of BC131542 Sequence: EVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTI Predict reactive species
Full Name: solute carrier family 5 (sodium/glucose cotransporter), member 2
Calculated Molecular Weight: 672 aa, 73 kDa
Observed Molecular Weight: 73 kDa
GenBank Accession Number: BC131542
Gene Symbol: SGLT2
Gene ID (NCBI): 6524
RRID: AB_2918190
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P31639
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924