Iright
BRAND / VENDOR: Proteintech

Proteintech, 28683-1-AP, SGLT2 Polyclonal antibody

CATALOG NUMBER: 28683-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SGLT2 (28683-1-AP) by Proteintech is a Polyclonal antibody targeting SGLT2 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat samples 28683-1-AP targets SGLT2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Sodium-glucose cotransporter 2 (SGLT2), encoded by SLC5A2, utilizes the electrochemical sodium gradient to transport glucose against the cell's internal concentration gradient. Mainly expressed on brush border membrane (BBM) of epithelial cells in the early segment of the proximal tubule, SGLT2 mediates most of the glucose reabsorption by the kidney overall. Inhibition of SGLT2 could improve glucose homeostasis of diabetic patients, which has been considered as a novel strategy for diabetes treatment. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30120 Product name: Recombinant human SLC5A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-285 aa of BC131542 Sequence: EVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTI Predict reactive species Full Name: solute carrier family 5 (sodium/glucose cotransporter), member 2 Calculated Molecular Weight: 672 aa, 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC131542 Gene Symbol: SGLT2 Gene ID (NCBI): 6524 RRID: AB_2918190 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31639 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924