Iright
BRAND / VENDOR: Proteintech

Proteintech, 28702-1-AP, METAP1 Polyclonal antibody

CATALOG NUMBER: 28702-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The METAP1 (28702-1-AP) by Proteintech is a Polyclonal antibody targeting METAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 28702-1-AP targets METAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A375 cells, HCT-116 cells, HUVEC cells, HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information METAP1 (methionyl aminopeptidase 1), also known as MAP1A or MetAP1A, is expected to be located in cytosol and widely expressed in esophagus and testis. The calculated molecular weight of METAP1 is 43 kDa. METAP1 is expected to have aminopeptidase activity and metallo-exopeptidase activity. It is also involved in platelet aggregation. At the same time, HsMetAP1 participates in co-translation to remove N- terminal methionine from newborn protein. Studies have shown that when HsMetAP1 is knocked down by gene-specific siRNA, cells show slow progress in G(2)/M phase, which is similar to cells treated with MetAP1 inhibitors. Importantly, MetAP1 inhibitors can induce apoptosis of leukemia cell lines, which may be the result of their interference with G(2)/M checkpoint. Therefore, it is necessary for normal cell cycle, especially in G(2)/M phase of cell cycle, and it can be used as a promising target for discovering and developing new anticancer drugs (PMID: 17114291). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29828 Product name: Recombinant human METAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-167 aa of NM_015143 Sequence: MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEID Predict reactive species Full Name: methionyl aminopeptidase 1 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: NM_015143 Gene Symbol: METAP1 Gene ID (NCBI): 23173 RRID: AB_3086080 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53582 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924