Proteintech, 28771-1-AP, MYO1E Polyclonal antibody

Size: 20ul / 150ul The MYO1E (28771-1-AP) by Proteintech is a Polyclonal antibody targeting MYO1E in WB, ELISA applications with reactivity to human samples 28771-1-AP targets MYO1E in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30338 Product name: Recombinant human MYO1E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 930-1044 aa of BC098392 Sequence: PTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPK Predict reactive species Full Name: myosin IE Calculated Molecular Weight: 1108 aa, 127 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC098392 Gene Symbol: MYO1E Gene ID (NCBI): 4643 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12965 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.