Proteintech, 28816-1-AP, DIS3L2 Polyclonal antibody

Size: 20ul / 150ul The DIS3L2 (28816-1-AP) by Proteintech is a Polyclonal antibody targeting DIS3L2 in WB, ELISA applications with reactivity to human, mouse samples 28816-1-AP targets DIS3L2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A2780 cells, HEK-293 cells, HEK-293T cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30634 Product name: Recombinant human DIS3L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-201 aa of BC036113 Sequence: VVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKG Predict reactive species Full Name: DIS3 mitotic control homolog (S. cerevisiae)-like 2 Observed Molecular Weight: 65 kDa, 99 kda GenBank Accession Number: BC036113 Gene Symbol: DIS3L2 Gene ID (NCBI): 129563 RRID: AB_2881217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.